Product Name: AIF Blocking Peptide
Synonyms: Apoptosis-Inducing Factor Programmed Cell Death Protein 8Medchemexpress
Product Overview: Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) · To be used in conjunction with Cayman’s AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation during analysis for AIF.Each
Shipping: wet ice
CAS NO: 170364-57-5 Enzastaurin
Stability: Store at -20 degrees; shelf life 730 days maximum after production
Molecular Formula:
SMILES: Phenols inhibitors
Molecular Weight:
Formulation: 200 µg lyophilized peptide
Purity: PubMed ID:http://www.bloodjournal.org/content/129/24/3245