Product Name :
Urodilatin, Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (human, bovine, porcine) peptide
Sequence Shortening :
TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY(disulfide bond)
Sequence :
H-Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH
Length (aa) :
32
Peptide Purity (HPLC) :
95.4%
Molecular Formula :
C145H234N52O44S3
Molecular Weight :
3505.98 net
Source :
Synthetic
Form :
Powder
Description :
Urodilatin, a 32 amino acid peptide, has originally been isolated from human urine. It belongs to the family of natriuretic-vasorelaxant peptides earlier found in heart atria. Cedidi et al. showed that urodilatin infusion may represent a concept for the treatment of therapy-resistant acute renal failure after liver transplantation.The use of H-3046 is protected by patents. It is sold by Hanhong for research purposes only, by expressed permission of Pharis Biotec GmbH, Hannover, Germany (www.
Storage Guidelines :
Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual:Handling and Storage of Synthetic Peptides
References :
M.Gagelmann et al., FEBS Lett., 233, 249 (1988) V.di Marzo et al., Trends Pharmacol. Sci., 10, 91 (1989) A.J.Kenny et al., Biochem. J., 291, 83 (1993) T.Fluge et al., Eur. J. Pharmacol., 271, 395 (1994) C.Cedidi et al., Eur. J. Clin. Invest., 24, 632 (1994)
About TFA salt :
Trifluoroacetic acid (TFA) has a significant impact on peptides due to its role in the peptide synthesis process. TFA is essential for the protonation of peptides that lack basic amino acids such as Arginine (Arg), Histidine (His), and Lysine (Lys), or ones that have blocked N-termini. As a result, peptides often contain TFA salts in the final product. TFA residues, when present in custom peptides, can cause unpredictable fluctuations in experimental data. At a nanomolar (nM) level, TFA can influence cell experiments, hindering cell growth at low concentrations (as low as 10 nM) and promoting it at higher doses (0.5–7.0 mM). It can also serve as an allosteric regulator on the GlyR of glycine receptors, thereby increasing receptor activity at lower glycine concentrations. In an in vivo setting, TFA can trifluoroacetylate amino groups in proteins and phospholipids, inducing potentially unwanted antibody responses. Moreover, TFA can impact structure studies as it affects spectrum absorption.
Related websites: https://www.medchemexpress.com/peptides/Peptide_Protein.html
Popular product recommendations:
HY-P1036A
HY-P1044A
