Product Name: Prostaglandin I Synthase Blocking Peptide
Synonyms: PGI Synthase PGIS Prostacyclin SynthaseWeb Site click
Product Overview: Peptide Sequence: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT) · To be used in conjunction with Cayman’s PGIS polyclonal antibody (Catalog No. 160640) to block protein-antibody complex formation during analysis for PGIS.To b
Shipping: wet ice
CAS NO: 27848-84-6 Product: Nicergoline
Stability: Store at -20 degrees; shelf life 730 days maximum after production
Molecular Formula:
SMILES: mTOR inhibitors
Molecular Weight:
Formulation: A lyophilized peptide
Purity: PubMed ID:http://aac.asm.org/content/58/6/3441.abstract