Product Name: EP4 Receptor (C-Term) Blocking Peptide
Synonyms: PGE2 Receptor 4 Prostaglandin E2 Receptor 4Web Site click
Product Overview: Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) · To be used in conjunction with Cayman’s EP4 receptor polyclonal antibody (Catalog No. 101775) to block protein-antibody complex formation d
Shipping: wet ice
CAS NO: 834903-43-4 Product: CID 16020046
Stability: Store at -20 degrees; shelf life 730 days maximum after production
Molecular Formula:
SMILES: Fungal inhibitors
Molecular Weight:
Formulation: A lyophilized peptide
Purity: PubMed ID:http://aac.asm.org/content/58/3/1273.abstract